KP1, KL1-derived peptide, Klotho-derived peptide 56-87, Klotho-derived peptide Phe57-Gly86, Tocris 7830 · Evidence-based safety and harm-reduction overview.
| Also known as | KP1, KL1-derived peptide, Klotho-derived peptide 56-87, Klotho-derived peptide Phe57-Gly86, Tocris 7830 |
| Category | Peptide (research chemical) |
| Sequence length | 30 amino acids (FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG) |
| Primary target | TGF-beta receptor 2 (TbetaR2) - competitive antagonist |
| Development stage | Preclinical only; no FDA IND or registered human trial as of mid-2026 |
| Research origin | Southern Medical University / University of Pittsburgh; lead investigators Youhua Liu and Lili Zhou |
| Catalog availability | Tocris 7830, Cayman Chemical, MedChemExpress, GenScript, TargetMol, Phoenix Pharmaceuticals |
| Animal models studied | Renal ischemia-reperfusion, obstructive nephropathy, CCl4 hepatotoxicity, bile duct ligation, COVID-19-associated AKI |
| US legal status | Not FDA-approved and not currently in clinical development. KP1 is available exclusively as a research reagent from chemical suppliers (Tocris/Bio-Techne, Cayman Chemical, Phoenix Pharmaceuticals, MedChemExpress, TargetMol, GenScript). It carries no DEA or controlled-substance designation. It is not approved for human therapeutic use in any jurisdiction known to the research literature reviewed. |
Klotho-Derived Peptide 1 (KP1) is a synthetic 30-amino acid peptide (sequence: FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG) designed as a mimetic of the KL1 domain of the endogenous aging-suppressor protein alpha-Klotho. It functions as a competitive inhibitor of TGF-beta signaling by directly binding TGF-beta receptor 2, and has demonstrated anti-fibrotic and anti-senescence effects in rodent models of kidney and liver injury. All human efficacy and safety data are absent; KP1 is strictly a preclinical research compound as of mid-2026.
KP1 binds directly to transforming growth factor beta receptor 2 (TbetaR2), competitively blocking TGF-beta ligand engagement. This suppresses both the canonical Smad-dependent pathway and the non-canonical MAPK-dependent pathway downstream of TGF-beta. Additionally, KP1 restores endogenous alpha-Klotho expression at the posttranscriptional level in fibrotic tissue and inhibits fibroblast activation and cellular senescence markers. Because it targets a discrete receptor-binding interface derived from an endogenous protein domain rather than disrupting systemic Klotho signaling, preclinical authors note it does not appear to alter blood phosphorus or calcium homeostasis - though this observation comes from rodent data only.
KP1 was identified and synthesized through research led by Youhua Liu and Lili Zhou at Southern Medical University (Guangzhou, China) in collaboration with the University of Pittsburgh. The peptide sequence was derived from the KL1 domain of full-length alpha-Klotho, motivated by the challenge that the intact Klotho protein is large, difficult to manufacture at scale, and produces off-target hormonal effects when administered exogenously. Initial in vitro and murine in vivo work was published in Nature Communications in 2022, establishing the kidney fibrosis protective effect. Follow-on publications through 2024 extended findings to hepatic fibrosis models (International Journal of Biological Sciences) and COVID-19-associated acute kidney injury. The peptide is available as a commercial research reagent under catalog number Tocris 7830. No pharmaceutical company has claimed development rights or initiated a regulatory filing as of the research reviewed.
All published evidence is preclinical. In murine models - including renal ischemia-reperfusion injury, obstructive nephropathy (unilateral ureteral obstruction), carbon tetrachloride hepatotoxicity, and bile duct ligation - KP1 administration reduced histological fibrosis scores and preserved organ function compared to controls. Pharmacokinetic studies in mice showed preferential accumulation of the peptide in injured or fibrotic tissue relative to healthy tissue, which authors interpreted as a favorable distribution profile. In cell culture, KP1 blocked TGF-beta signaling in hepatic stellate cells, kidney fibroblasts, and renal tubular epithelial cells, and inhibited senescence markers including p16 and p21. No human clinical trial data exists. A ClinicalTrials.gov record (NCT03532568) studies soluble Klotho protein in CKD-associated pruritus - this is a distinct molecule from KP1 and does not constitute clinical evidence for the peptide.
Published murine studies report intraperitoneal or intravenous administration at doses in the microgram-to-milligram-per-kilogram range in rodent models; exact reported ranges vary by study and model. These figures are presented here as literature context only and do not constitute a human dosing protocol. Rodent dose-to-human translation for peptides is not straightforward and cannot be made without clinical pharmacokinetic data, which does not exist for KP1. No dosing guidance for human use should be inferred from animal data. Anyone considering any investigational peptide for personal use should consult a licensed clinician.
This is general research/context information, not medical advice or a recommended protocol.
No stacking data exists for KP1 in humans. Animal studies tested KP1 as a monotherapy in isolated fibrosis models. Combination use with other compounds is entirely uninvestigated and cannot be evaluated from existing literature.
Liver Let Live. For liver and metabolic support, our Liver Support formula is a legal supplement option.
See our recommended pickFind Klotho-Derived Peptide 1 (KP1) →
Order your own bloodwork online — hormone, metabolic and inflammation panels, no doctor visit needed. Know your baselines before and during any protocol. Independent bloodwork is the cheapest insurance there is.
Get tested with Ulta Lab Tests →No. KP1 is not FDA-approved and has no regulatory approval in any jurisdiction. It is sold exclusively as a research reagent and has no legal therapeutic indication.
No human clinical trial data exists for KP1 as of mid-2026. All published efficacy data comes from murine animal models and in vitro cell culture. A ClinicalTrials.gov record (NCT03532568) studies soluble Klotho protein in kidney disease - this is an entirely distinct molecule and does not represent clinical evidence for KP1.
In rodent models only, KP1 has shown reduced fibrosis in kidney ischemia-reperfusion injury, obstructive nephropathy, carbon tetrachloride liver toxicity, bile duct ligation-induced hepatic fibrosis, and COVID-19-associated acute kidney injury. These are animal findings and cannot be directly extrapolated to human disease outcomes.
No dosing recommendation for humans can be made. Rodent studies report dosing in microgram-to-milligram per kilogram ranges via injection, but human pharmacokinetics are entirely unknown. Anyone considering any investigational compound should consult a licensed clinician before use.
Preclinical data suggests KP1 does not disrupt phosphorus and calcium homeostasis the way exogenous full-length Klotho protein does in mice, which authors interpret as a safety advantage. However, this comparison is based on rodent data only, and human safety for either agent is unestablished. The inference that endogenous-protein-derived peptides are inherently safe in humans is not supported by comprehensive toxicology data.
KP1 is at an early preclinical stage with no pharmaceutical sponsor, no IND application, and no registered human trial as of mid-2026. Published research from 2022 to 2024 establishes mechanism and animal efficacy, but the compound has not advanced beyond academic research. Its trajectory toward clinical development is speculative.
Medical & legal disclaimer. This site is for informational and harm-reduction purposes only. It is not medical advice and is not a substitute for a licensed healthcare professional. The compounds discussed are largely not approved by the FDA for human use and many are sold strictly as research chemicals 'not for human consumption.' Nothing here is an endorsement to purchase, possess, or use any substance. Laws vary by jurisdiction. Always consult a qualified physician and follow the law where you live.
Some links on this page may be affiliate links. If you buy through them we may earn a commission at no extra cost to you. This never changes the safety information we publish.